PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold08893-augustus-gene-0.7-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB_related
Protein Properties Length: 245aa    MW: 27145.7 Da    PI: 5.1786
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold08893-augustus-gene-0.7-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.8e-13246347
                                                  SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                               Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                                  +WT+eE+ l++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
  maker-scaffold08893-augustus-gene-0.7-mRNA-1  2 PWTEEEHRLFLLGLQKLGKGDWRGIARNFVMSRTPTQVASHAQKY 46
                                                  8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015579.7E-18150IPR006447Myb domain, plants
SMARTSM007175.5E-8149IPR001005SANT/Myb domain
PROSITE profilePS5129420.171151IPR017930Myb domain
CDDcd001673.61E-10247No hitNo description
SuperFamilySSF466891.57E-15252IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-11245IPR009057Homeodomain-like
PfamPF002491.5E-11246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
VPWTEEEHRL FLLGLQKLGK GDWRGIARNF VMSRTPTQVA SHAQKYFIRQ TNANRRKRRS  60
SLFDMVPDMS TDTPSVPEEQ VLLPSAQARE TDTANPLPSL NLSLNSEFEP MEAIPQEEAK  120
ESDESVTGSG GMAPMIPEFF PAFLTLPFPI WQPNTAPVEE EKGAETSHHQ VLKPIPILPK  180
EPVNVDELVG LSQLSLREAE RLHREPSPLS LKLIGTPSRQ SAFHANAPVN GSDLNKGESS  240
VIQAV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4293566e-47AB429356.1 Bruguiera gymnorhiza mRNA for myb transcription factor, complete cds, clone: Bg01-04_N14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902398.11e-129PREDICTED: uncharacterized protein LOC107435329
RefseqXP_015902404.11e-129PREDICTED: uncharacterized protein LOC107435334
TrEMBLA0A0B2RLB01e-123A0A0B2RLB0_GLYSO; Transcription factor MYB1R1
TrEMBLA0A0R4J5531e-123A0A0R4J553_SOYBN; Uncharacterized protein
STRINGGLYMA13G43120.11e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.12e-55MYB_related family protein